PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G159900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 337aa    MW: 38319 Da    PI: 6.3657
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G159900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-171360148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg W++eEde+lv++++ +G  +W+++++  g+ R++k+c++rw +yl
  Aqcoe1G159900.1.p 13 RGLWSPEEDEKLVKCINTHGHSCWSAVPKLAGLQRCGKSCRLRWINYL 60
                       788*******************************************97 PP

2Myb_DNA-binding51.32.7e-1666109146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg+++++E+ +++d+++ lG++ W+ Ia++++ gRt++++k++w++
  Aqcoe1G159900.1.p  66 RGSFSAQEERIIIDVHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 109
                        899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-25463IPR009057Homeodomain-like
PROSITE profilePS5129416.984860IPR017930Myb domain
SuperFamilySSF466891.12E-2810107IPR009057Homeodomain-like
SMARTSM007179.4E-141262IPR001005SANT/Myb domain
PfamPF002496.5E-161360IPR001005SANT/Myb domain
CDDcd001671.30E-111660No hitNo description
PROSITE profilePS5129425.75761115IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-2564115IPR009057Homeodomain-like
SMARTSM007178.8E-1665113IPR001005SANT/Myb domain
PfamPF002491.0E-1466109IPR001005SANT/Myb domain
CDDcd001671.62E-1168108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGHHCCSKQK VKRGLWSPEE DEKLVKCINT HGHSCWSAVP KLAGLQRCGK SCRLRWINYL  60
RPDLKRGSFS AQEERIIIDV HRILGNRWAQ IAKHLPGRTD NEVKNFWNSC IKKKLLAQGL  120
DPKTHNLMPP SQQNIKNACN VNQFYQQPPS VFSMNSQFRS DNNVTPMDIN QSFITLAPPH  180
PPNTNIYPPS LDQAMSTFNY QNQNHVWTTN AQNSEPSSDF TRQSLIPISS SSMIGSSGFD  240
FPDHENNNMW DDGGMEALVS PRQEEMKQTP VPQGLTQQEK VCEVQLEEER DGHHQDMDTS  300
FSDCSNFDLE FMESPLMPCG LMYSNMNSMD QLAWDA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31131157108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016544702.11e-114PREDICTED: myb-related protein 330-like
SwissprotQ9SPG32e-67MYB26_ARATH; Transcription factor MYB26
TrEMBLM1ABB61e-104M1ABB6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000188971e-104(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.15e-83myb domain protein 67